Protein Info for GFF3947 in Xanthobacter sp. DMC5

Annotation: nicotinate-nucleotide adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF01467: CTP_transf_like" amino acids 29 to 208 (180 residues), 59.2 bits, see alignment E=2.7e-20 TIGR00482: nicotinate (nicotinamide) nucleotide adenylyltransferase" amino acids 29 to 210 (182 residues), 118.3 bits, see alignment E=2.2e-38

Best Hits

Swiss-Prot: 67% identical to NADD_BRADU: Probable nicotinate-nucleotide adenylyltransferase (nadD) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K00969, nicotinate-nucleotide adenylyltransferase [EC: 2.7.7.18] (inferred from 82% identity to xau:Xaut_2059)

Predicted SEED Role

"Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.7.7.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>GFF3947 nicotinate-nucleotide adenylyltransferase (Xanthobacter sp. DMC5)
MSSGPLVEPVTPRAARRLPFVTEGLRVGLFGGSFNPAHAAHRAASLLALRRLGLDRVWWL
VTPGNPLKDNRALPPLEERIAIARAVAHHPRIDVTGFEAGIGTRYTYETLAYLVRRLPGV
RFVWIMGADNLAHFDRWQHWRGIADLVPIAVVDRMGQSLAATASPAAQALARYRLGEHEA
RLLADCAPPAWVFLHGLKSPLSSTGIRAARALPEGHRIEVACHTS