Protein Info for GFF3946 in Xanthobacter sp. DMC5

Annotation: Gamma-glutamyl phosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 PF00171: Aldedh" amino acids 31 to 303 (273 residues), 52.2 bits, see alignment E=2e-18 TIGR00407: glutamate-5-semialdehyde dehydrogenase" amino acids 35 to 429 (395 residues), 442.5 bits, see alignment E=6.6e-137

Best Hits

Swiss-Prot: 74% identical to PROA_RHOP2: Gamma-glutamyl phosphate reductase (proA) from Rhodopseudomonas palustris (strain HaA2)

KEGG orthology group: K00147, glutamate-5-semialdehyde dehydrogenase [EC: 1.2.1.41] (inferred from 86% identity to xau:Xaut_2058)

MetaCyc: 44% identical to glutamate-5-semialdehyde dehydrogenase (Escherichia coli K-12 substr. MG1655)
Glutamate-5-semialdehyde dehydrogenase. [EC: 1.2.1.41]

Predicted SEED Role

"Gamma-glutamyl phosphate reductase (EC 1.2.1.41)" in subsystem Proline Synthesis (EC 1.2.1.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>GFF3946 Gamma-glutamyl phosphate reductase (Xanthobacter sp. DMC5)
MSTASALRTDAAATAGRLVPPAELEAVMLAMGKRARAASRSLALAAPEAKTQALKAAAAA
IRAASGEILAANAIDVAKAKAEGMTGSFLDRLTLTPARVEAMAEGVEQVAELADPIGLVT
ERWTRPNGLIIERVRTPLGVIGVIYESRPNVTADAAALCLRAGNAVILRGGSDSLNSSGA
IHRAFVAGLTAAGLPEDAVQFVNVPDRAAVGHMLAGLGNTVDVIVPRGGKSLVARVQSDA
RVPVFAHLDGINHVYVDKAANLDMAKTVVLNAKMRRTGVCGAAETLLIDRAVAGTHLKPL
VEMLIDAGCEIRGDAEVQAVDARVKPALPEDWDTEYLDAIIAAKVVDGVGDAIAHIEAHG
SHHTDSIVTEDAAAADRFLAEVDSAIVLHNASTQFADGGEFGFGAEIGIATGRMHARGPV
GAEQLTSFKYRIHGSGQTRP