Protein Info for GFF3944 in Xanthobacter sp. DMC5

Annotation: Glutamate 5-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 TIGR01027: glutamate 5-kinase" amino acids 26 to 386 (361 residues), 402.3 bits, see alignment E=1e-124 PF00696: AA_kinase" amino acids 27 to 257 (231 residues), 135.5 bits, see alignment E=2.5e-43 PF01472: PUA" amino acids 298 to 370 (73 residues), 73.3 bits, see alignment E=1.3e-24

Best Hits

Swiss-Prot: 71% identical to PROB_RHOPT: Glutamate 5-kinase (proB) from Rhodopseudomonas palustris (strain TIE-1)

KEGG orthology group: K00931, glutamate 5-kinase [EC: 2.7.2.11] (inferred from 90% identity to xau:Xaut_2056)

Predicted SEED Role

"Glutamate 5-kinase (EC 2.7.2.11) / RNA-binding C-terminal domain PUA" in subsystem Proline Synthesis (EC 2.7.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>GFF3944 Glutamate 5-kinase (Xanthobacter sp. DMC5)
MASPETASFESSSDAQAKTPAFADFRRIVIKVGSALLVDRAQGRVRLAWLTSLVEDIAAL
HAKGCEVMVVSSGAIALGRTVLGLPAGPLKLEDSQAAAAVGQIALSKTWADILGHYNITA
GQVLLTLGDTEERRRYLNARSTLGRLMELRSVPIINENDTVATTEIRYGDNDRLAARVAT
MASADLLVLLSDIDGLYTAPPAQDPNATLIPVVARIGAEIEAIAGDAGSELSRGGMRTKI
EAGKIATSAGTHMVIASGHVKNPLKRIMEGGRCTWFLTSANPVRARKSWIAGALEPRGTL
HLDDGAVAALRRGASLLPAGVKRIDGQFDRGDAVVLRGPDGAEVGRGLVAYDSNHAARIM
GHSTSEIEALLGVKGRSEMVHRDDLALGVE