Protein Info for GFF3943 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Propanediol dehydratase small subunit (EC 4.2.1.28)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 PF02287: Dehydratase_SU" amino acids 39 to 170 (132 residues), 211.2 bits, see alignment E=2.7e-67

Best Hits

Swiss-Prot: 100% identical to PDUE_SALTY: Propanediol dehydratase small subunit (pduE) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K13920, propanediol dehydratase small subunit [EC: 4.2.1.28] (inferred from 98% identity to sei:SPC_1672)

MetaCyc: 100% identical to propanediol dehydratase small subunit (Salmonella enterica enterica serovar Typhimurium str. LT2)
Propanediol dehydratase. [EC: 4.2.1.28]; 4.2.1.28 [EC: 4.2.1.28]

Predicted SEED Role

"Propanediol dehydratase small subunit (EC 4.2.1.28)" in subsystem Propanediol utilization (EC 4.2.1.28)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.28

Use Curated BLAST to search for 4.2.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (173 amino acids)

>GFF3943 Propanediol dehydratase small subunit (EC 4.2.1.28) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNTDAIESMVRDVLSRMNSLQGDAPAAAPAAGGTSRSAKVSDYPLANKHPEWVKTATNKT
LDDFTLENVLSNKVTAQDMRITPETLRLQASIAKDAGRDRLAMNFERAAELTAVPDDRIL
EIYNALRPYRSTKEELLAIADDLENRYQAKICAAFVREAAGLYVERKKLKGDD