Protein Info for GFF394 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: L-threonine 3-dehydrogenase (EC 1.1.1.103)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 TIGR00692: L-threonine 3-dehydrogenase" amino acids 3 to 340 (338 residues), 625.1 bits, see alignment E=1.4e-192 PF08240: ADH_N" amino acids 25 to 137 (113 residues), 102.6 bits, see alignment E=1.9e-33 PF00107: ADH_zinc_N" amino acids 174 to 303 (130 residues), 100.9 bits, see alignment E=7.9e-33

Best Hits

Swiss-Prot: 100% identical to TDH_SALSV: L-threonine 3-dehydrogenase (tdh) from Salmonella schwarzengrund (strain CVM19633)

KEGG orthology group: K00060, threonine 3-dehydrogenase [EC: 1.1.1.103] (inferred from 100% identity to spq:SPAB_04605)

MetaCyc: 97% identical to threonine dehydrogenase (Escherichia coli K-12 substr. MG1655)
L-threonine 3-dehydrogenase. [EC: 1.1.1.103]

Predicted SEED Role

"L-threonine 3-dehydrogenase (EC 1.1.1.103)" in subsystem Glycine Biosynthesis or Threonine degradation (EC 1.1.1.103)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.103

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>GFF394 L-threonine 3-dehydrogenase (EC 1.1.1.103) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKALSKLKAEEGIWMTDVPEPEVGHNDLLIKIRKTAICGTDVHIYNWDDWSQKTIPVPMV
VGHEYVGEVVGIGQEVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTTGVGVNRPGC
FAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDLVGEDVLVSGAGPIGVMAA
AVAKHVGARHVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMAELGMTEGFDVGLEMS
GAPPAFRTMLDTMNHGGRIAMLGIPPSDMSIDWTKVIFKGLFIKGIYGREMFETWYKMAA
LIQSGLDLSPIITHRFSIDDFQKGFDAMRSGQSGKVILSWD