Protein Info for GFF3935 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: ATP:Cob(I)alamin adenosyltransferase (EC 2.5.1.17)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 PF01923: Cob_adeno_trans" amino acids 3 to 166 (164 residues), 195.2 bits, see alignment E=9e-62 TIGR00636: ATP:cob(I)alamin adenosyltransferase" amino acids 4 to 177 (174 residues), 166.1 bits, see alignment E=3e-53 PF03928: HbpS-like" amino acids 201 to 328 (128 residues), 113 bits, see alignment E=1e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to stm:STM2050)

MetaCyc: 100% identical to corrinoid adenosyltransferase PduO (Salmonella enterica enterica serovar Typhimurium str. LT2)
Cob(I)yrinic acid a,c-diamide adenosyltransferase. [EC: 2.5.1.17]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.17

Use Curated BLAST to search for 2.5.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>GFF3935 ATP:Cob(I)alamin adenosyltransferase (EC 2.5.1.17) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MAIYTRTGDAGTTSLFTGQRVSKTHPRVEAYGTLDELNAALSLCACAAADENHRTLLEAI
QQQLFWFSAELASDSEQPSPKQRYISSEEISALEAAIDRAMARVEPLHSFILPGRCEAAS
RLHFARTLARRAERRLVELATEVNVRQVLMRYINRLSDCLYALARAEDSDAHQANIIREV
SKRYLAACQPPHSKETTPVALSFHDLHQLTRAAVERAQQLQVPVVVSIVDAHGTETVTWR
MPDALLVSSELAPKKAWTAVAMKTATHELSDVVQPGAALYGLESHLQGKVVTFGGGYALW
RDGILIGGLGISGGSVEQDMDIAQTAIAAINVGTHQ