Protein Info for GFF3932 in Sphingobium sp. HT1-2

Annotation: putative membrane-associated phospholipid phosphatase, PAP2 superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 50 to 73 (24 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details PF01569: PAP2" amino acids 83 to 191 (109 residues), 73.8 bits, see alignment E=5.7e-25

Best Hits

KEGG orthology group: None (inferred from 69% identity to sjp:SJA_C1-20610)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (195 amino acids)

>GFF3932 putative membrane-associated phospholipid phosphatase, PAP2 superfamily (Sphingobium sp. HT1-2)
MFILALFCVLGIALLQRNGLLDDLNIGLMGWAGQGRETALGGQVTMVMRLASAIGGTAIR
IILSLVVLGALVFTGRRAAASWFAGVEIGGTLLNLILKQIFAAPRPDLLPHLDIVHSYSF
PSGHAAGNMMFFGALAMLAGRRWAYGAGGAMIALIGVSRVWLGVHWPSDVMAGWIEGLGW
LMLCAVWLPARRGQQ