Protein Info for GFF3932 in Pseudomonas sp. DMC3

Annotation: Riboflavin transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 40 to 63 (24 residues), see Phobius details amino acids 83 to 100 (18 residues), see Phobius details amino acids 106 to 124 (19 residues), see Phobius details amino acids 131 to 148 (18 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 269 to 287 (19 residues), see Phobius details PF00892: EamA" amino acids 15 to 147 (133 residues), 62.4 bits, see alignment E=2.8e-21 amino acids 157 to 281 (125 residues), 35.1 bits, see alignment E=7.7e-13

Best Hits

KEGG orthology group: None (inferred from 96% identity to pfo:Pfl01_4908)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>GFF3932 Riboflavin transporter (Pseudomonas sp. DMC3)
MTVSTPLSGVNQPFKGILLIVVATFLFSSHDALSKYLSGFYPIVMVVWARYVVHTLLMAG
IFLPQSGLRVLRTKKPLWQLARALCLLGTSLFFTTALLYIPLAEATAVNFLAPVLVTALS
VPLLKERVTRGQWIAVICGFIGVLIIVHPGGELFTPAILLPFCSALFFCFYQLLTRKLAE
VDSPTTSNFFAGLCNTLVMSALVPFFWQVPTWTHAALMLALGSCGMTAHLFLTQAFRHAA
PALLAPFGYCQIVFAGLLGWLLFNHTPSGLTVIGIAVICCSGLAAAWQQSRR