Protein Info for GFF3932 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Cob(III)alamin reductase @ Cob(II)alamin reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 PF01512: Complex1_51K" amino acids 21 to 160 (140 residues), 133.7 bits, see alignment E=1.1e-42 PF10531: SLBB" amino acids 175 to 219 (45 residues), 37.5 bits, see alignment 3.4e-13 PF13534: Fer4_17" amino acids 264 to 324 (61 residues), 46.9 bits, see alignment E=6.6e-16 PF13375: RnfC_N" amino acids 381 to 447 (67 residues), 48.4 bits, see alignment E=1.6e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to seh:SeHA_C2276)

MetaCyc: 100% identical to cob(II)alamin reductase (Salmonella enterica enterica serovar Typhimurium str. LT2)
Cob(I)yrinic acid a,c-diamide adenosyltransferase. [EC: 2.5.1.154, 2.5.1.17]

Predicted SEED Role

"Cob(III)alamin reductase @ Cob(II)alamin reductase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.17

Use Curated BLAST to search for 2.5.1.154 or 2.5.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (451 amino acids)

>GFF3932 Cob(III)alamin reductase @ Cob(II)alamin reductase (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSTAINSVEMSLSADEIRERVRAAGVVGAGGAGFPAHVKLQAQVEIFLVNAAECEPMLKV
DQQLMWQQAARLVRGVQYAMTATGAREGVIALKEKYRRAIDALTPLLPDGIRLHILPDVY
PAGDEVLTIWMATGRRVAPAALPASVGVVVNNVQTVLNIARAVEQRFPVTRRTLTVNGAV
ARPLTVTVPIGMSLREVLALAGGATVDDPGFINGGPMMGGLITSLDNPVTKTTGGLLVLP
KSHPLIQRRMQDERTVLSVARTVCEQCRLCTDLCPRHLIGHELSPHLLVRAVNFHQAATP
QLLLSALTCSECNVCESVACPVGISPMRINRMLKRELRAQNQRYEGPLNPADEMAKYRLV
PVKRLIAKLGLSPWYQEAPLVEEEPSVEKVTLQLRQHIGASAVANVAVGERVTRGQCVAD
VPPGALGAPIHASIDGVVSAISEQAITVVRG