Protein Info for GFF3930 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Propanediol utilization polyhedral body protein PduU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 116 PF00936: BMC" amino acids 45 to 110 (66 residues), 48.3 bits, see alignment E=4.1e-17

Best Hits

Swiss-Prot: 100% identical to PDUU_SALTI: Propanediol utilization protein PduU (pduU) from Salmonella typhi

KEGG orthology group: K04031, ethanolamine utilization protein EutS (inferred from 95% identity to esc:Entcl_1742)

Predicted SEED Role

"Propanediol utilization polyhedral body protein PduU" in subsystem Propanediol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (116 amino acids)

>GFF3930 Propanediol utilization polyhedral body protein PduU (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MERQPTTDRMIQEYVPGKQVTLAHLIANPGKDLFKKLGLQDAVSAIGILTITPSEASIIA
CDIATKSGAVEIGFLDRFTGAVVLTGDVSAVEYALKQVTRTLGEMMQFTTCSITRT