Protein Info for GFF3929 in Xanthobacter sp. DMC5

Annotation: Inner membrane protein YbhL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 34 to 56 (23 residues), see Phobius details amino acids 64 to 82 (19 residues), see Phobius details amino acids 88 to 105 (18 residues), see Phobius details amino acids 117 to 135 (19 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details amino acids 195 to 213 (19 residues), see Phobius details amino acids 234 to 256 (23 residues), see Phobius details PF01027: Bax1-I" amino acids 28 to 256 (229 residues), 208.9 bits, see alignment E=3.9e-66

Best Hits

Swiss-Prot: 43% identical to Y3663_CAUVC: Uncharacterized protein CC_3663 (CC_3663) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K06890, (no description) (inferred from 93% identity to xau:Xaut_2043)

Predicted SEED Role

"FIG005935: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>GFF3929 Inner membrane protein YbhL (Xanthobacter sp. DMC5)
MSDYDRNVAGRFNPSVARSQAAIDQGLRTYMLSVYNYMALGLAITGAAALGIYMLSVTTD
PASAAGRIAGGIMLTQFGYALFVSPLKWVVMLAPLAAVFFLSFRIERMSVSAAQLTFWVY
AALVGVSLSTIFLVYTHESIVRVFFITAASFGALSLYGYTTQRDLSGMGSFLMMGLFGII
IASVVNIFLGSSMLQFIVSVVGVLVFAGLTAYDTQRIKEMYFAGDDVAVAGKKAIMGALA
LYLDFINLFMMLLQLFGGRNNE