Protein Info for GFF3929 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Replicative DNA helicase (EC 3.6.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 PF00772: DnaB" amino acids 33 to 134 (102 residues), 112.9 bits, see alignment E=1e-36 TIGR00665: replicative DNA helicase" amino acids 33 to 471 (439 residues), 571.2 bits, see alignment E=6.9e-176 PF03796: DnaB_C" amino acids 211 to 468 (258 residues), 362.2 bits, see alignment E=2.1e-112 PF13481: AAA_25" amino acids 226 to 391 (166 residues), 44.1 bits, see alignment E=2.8e-15

Best Hits

Swiss-Prot: 49% identical to DNAB_HAEIN: Replicative DNA helicase (dnaB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02314, replicative DNA helicase [EC: 3.6.4.12] (inferred from 86% identity to adk:Alide2_1327)

Predicted SEED Role

"Replicative DNA helicase (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (481 amino acids)

>GFF3929 Replicative DNA helicase (EC 3.6.1.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSTAFSSSFSSFDPGLDEVGGSADHQIAQLRVPPHSIEAESSVLGGLLLDNGAWDRVADL
INDSDFYRYEHRLAYSAIATLVNASKPADVVTVFEHLQSFGKAEEAGGLGYLNSLAQYVP
SAANIRRYAEIVRERAILRKLVAASDEIATAAFNPQGRPVAKILDEAEQKVFKIGEEGSR
MKEGFQSMDKLVVDLLDRVQEMADNPADVTGVPTGFIDLDRMTSGLQAGDLVVLAARPSM
GKTAFAINIAEHVALNEGLPVAVFSMEMGASQLAVRVVGSIGRINQGHLRTGKLTDDEWP
RLTEAIEKLRTVSLHIDETPGLTPSELRANARRLARQCGKLGLIVVDYLQLMSGSSAAGG
DNRATELGEISRGLKMLAKELQCPVIALSQLNRSVEQRTDKRPMMSDLRESGAIEQDADI
IMFIYRDEYYTRDACKEPGVAEIIIGKQRNGPTGTVKLAFLNMLTRFESLAGGGMGGGSD
Y