Protein Info for GFF3929 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Propanediol utilization protein PduV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 PF10662: PduV-EutP" amino acids 1 to 137 (137 residues), 195.8 bits, see alignment E=1.6e-62 TIGR02528: ethanolamine utilization protein, EutP" amino acids 1 to 138 (138 residues), 205.4 bits, see alignment E=2.1e-65

Best Hits

Swiss-Prot: 100% identical to PDUV_SALTY: Propanediol utilization protein PduV (pduV) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K04029, ethanolamine utilization protein EutP (inferred from 97% identity to sty:STY2261)

Predicted SEED Role

"Propanediol utilization protein PduV" in subsystem Propanediol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (146 amino acids)

>GFF3929 Propanediol utilization protein PduV (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MFIGPSQCGKTSLTQSLRGEALHYKKTQAIEWSPMAIDTPGEYLENRCLYSALLTSACEA
DVIALVLNADAQWSPFSPGFTAPMNRPTIGLVTKADLAEPQRISLVAEWLTQAGAQQIFI
TSALNNSGLDAVLDFLNSKEPLCLTK