Protein Info for GFF3926 in Variovorax sp. SCN45

Annotation: Ornithine carbamoyltransferase (EC 2.1.3.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02729: OTCace_N
  • amino acids 10 to 150 (141 residues), 161.2 bits, E=2e-51
• TIGR00658: ornithine carbamoyltransferase
  • amino acids 10 to 316 (307 residues), 363.3 bits, E=4.7e-113
• PF00185: OTCace
  • amino acids 166 to 314 (149 residues), 185.9 bits, E=5.4e-59

Best Hits

Swiss-Prot: 83% identical to OTC_ACIAC: Ornithine carbamoyltransferase (argF) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: None (inferred from 94% identity to vpe:Varpa_1606)

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• superpathway of arginine and polyamine biosynthesis (15/17 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-citrulline degradation (3/3 steps found)
• urea cycle (4/5 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• L-arginine degradation XIII (reductive Stickland reaction) (3/5 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)
• L-arginine degradation XIV (oxidative Stickland reaction) (1/6 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 2.1.3.3

Use Curated BLAST to search for 2.1.3.3

Protein Sequence (320 amino acids)

>GFF3926 Ornithine carbamoyltransferase (EC 2.1.3.3) (Variovorax sp. SCN45)
MTTATANTIRHYLQFADFTADEYAYLFDRMAVIKKKFKTYEKHQPLVDRTLAMIFEKAST
RTRVSFEAGMYQLGGSVVHLTTGDSQLGRAEPIEDSAKVISRMVDLVMIRTYEQTKIDAF
AAHSRVPVINGLTNEFHPCQILADIFTYIEHRGSRDAGGDALSCLKGKTVAWVGDGNNMA
NTWLQAAEILGFTVHVSTPSGYEVDQSIAGIRSGDSYKVFKDPMEACRGADLVTTDVWTS
MGYEAENEARRKAFADWCVDEDMMRAAQPDALFMHCLPAHRGEEVQAEVIDGPQSVVWDE
AENRLHAQKALMEFLLLGRL