Protein Info for GFF3922 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Acetate permease ActP (cation/acetate symporter)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 687 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 84 to 107 (24 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 165 to 189 (25 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 390 to 413 (24 residues), see Phobius details amino acids 425 to 446 (22 residues), see Phobius details amino acids 512 to 534 (23 residues), see Phobius details amino acids 561 to 579 (19 residues), see Phobius details amino acids 586 to 610 (25 residues), see Phobius details amino acids 617 to 635 (19 residues), see Phobius details amino acids 655 to 679 (25 residues), see Phobius details TIGR03648: probable sodium:solute symporter, VC_2705 subfamily" amino acids 48 to 682 (635 residues), 657.4 bits, see alignment E=7.7e-202 PF00474: SSF" amino acids 72 to 248 (177 residues), 106.3 bits, see alignment E=8.9e-35 amino acids 510 to 625 (116 residues), 53.4 bits, see alignment E=1e-18

Best Hits

KEGG orthology group: K14393, cation/acetate symporter (inferred from 71% identity to adk:Alide2_1664)

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (687 amino acids)

>GFF3922 Acetate permease ActP (cation/acetate symporter) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPDSPAYAAYQRRLHRFLAFYILALIAFLLLMAWAEQSGLSRRWLGPIFLFSTVMMYGGI
GIYSRTADPEEYYVAGRRIPPVYNGMAAAADWMSAASFISLAGGLYLQGFGGTETQAGGL
AYVLGWTGGFCLVALLIAPHLRKLNLYTVPDYFKERFGGRWPRRIAAFSAVLCSFTYVVA
QIYGIGLVASRLTGVQFEIGIMLGLGGVVLCSFLGGMKAITWTQVAQYIILLLAFLIPVS
WLAYKQLGSPLAPLVYGEQLEKIAKLEHELMASPAEQQVQAEFGRRAREYAVWLQDVEGT
LRRERAAKQERVRALKSQNADMALVVAATRELAALPPDVATARERWTRAMQESEERSRPL
GGLLPHSQAFAGDPDGTAAERETFQSSRANFLALMFCLMVGTAGLPHLLTRYYTTPSVAT
ARSSVAWSLFFITLLYLSAPALAVLVKYEVMQNVVGSSFDALPPWIAQWSRMDGSLVSVS
DINGDGILQFGELRLGADVIMLATPELGGMPYVVSGLVAAGGLAAALSTADGLLLTISNS
LVRDTYCHEVKRNVTPEQRVILSKFALLSVATLAAFVAALKPAEILPLVASSFSLAASAF
VPAMIMGIFWSRTTGPAAVAGMLIGLGTTVLYMMINAPTVRAFFALPAGQDLWFGIQPLS
AGVFGVPVGFVVIGLLSLLQRRKGTGA