Protein Info for GFF3922 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Thiosulfate reductase cytochrome B subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 transmembrane" amino acids 19 to 40 (22 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 169 to 194 (26 residues), see Phobius details amino acids 200 to 224 (25 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 59 to 239 (181 residues), 82.8 bits, see alignment E=1.4e-27

Best Hits

Swiss-Prot: 100% identical to PHSC_SALTY: Thiosulfate reductase cytochrome B subunit PhsC (phsC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K08354, thiosulfate reductase cytochrome b subunit (inferred from 99% identity to sed:SeD_A2399)

MetaCyc: 100% identical to thiosulfate reductase (quinone) gamma subunit (Salmonella enterica enterica serovar Typhimurium)
RXN-18001 [EC: 1.8.5.5]

Predicted SEED Role

"Thiosulfate reductase cytochrome B subunit" in subsystem Anaerobic respiratory reductases

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>GFF3922 Thiosulfate reductase cytochrome B subunit (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNTIWGAELHYAPDYWPLWLIYAGVVVLLMLVGLVIHALLRRMLAPKTAGGEEHRDYLYS
LAIRRWHWGNALLFVLLLLSGLFGHFSLGPVALMVQVHTWCGFALLAFWVGFVLINLTTG
NGRHYRVNFSGLVTRCIRQTRFYLFGIMKGEAHPFVATEQNKFNPLQQLAYLAIMYALVP
LLIITGLLCLYPQVAGLGPVMLVLHMALAIIGLLFICAHLYLCTLGDTPGQIFRSMVDGY
HRHRTAPRGDKSAV