Protein Info for GFF3917 in Variovorax sp. SCN45

Annotation: Ferrous iron transporter FeoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 631 transmembrane" amino acids 235 to 256 (22 residues), see Phobius details amino acids 286 to 314 (29 residues), see Phobius details amino acids 341 to 359 (19 residues), see Phobius details amino acids 372 to 396 (25 residues), see Phobius details amino acids 408 to 429 (22 residues), see Phobius details amino acids 464 to 485 (22 residues), see Phobius details amino acids 563 to 582 (20 residues), see Phobius details amino acids 602 to 625 (24 residues), see Phobius details PF02421: FeoB_N" amino acids 20 to 178 (159 residues), 170.5 bits, see alignment E=4e-54 PF01926: MMR_HSR1" amino acids 20 to 136 (117 residues), 57.4 bits, see alignment E=3e-19 PF07670: Gate" amino acids 298 to 393 (96 residues), 75.7 bits, see alignment E=7.5e-25 amino acids 470 to 600 (131 residues), 66 bits, see alignment E=7.7e-22 PF07664: FeoB_C" amino acids 411 to 463 (53 residues), 59.7 bits, see alignment 3.6e-20

Best Hits

KEGG orthology group: K04759, ferrous iron transport protein B (inferred from 95% identity to vpe:Varpa_1596)

Predicted SEED Role

"Ferrous iron transport protein B" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (631 amino acids)

>GFF3917 Ferrous iron transporter FeoB (Variovorax sp. SCN45)
MVEAVIQGPGGFAATAQPGRIALLGNPNCGKTALFNLLTGSRQKVANYAGVTVERKEGTL
RTPSGRRVFVLDLPGAYSLNALSADEAVTRDIVTGQSKEALPELLVCVTDATNLRLNLRL
VLEARRLGLPMVMALNMTDMAKKQGIAVDTAVLSRELGIPVIETVGVHTGGAQGLLEALD
LPVATAAPQPWQAPGLDDVLATQREVRRILGLAVKEPVGSLATSDRIDRVVLHPVWGMLV
LAVTMFLMFQAVFSWANVPMDAIKAGTEALGGLIKTHMGEGMLQSLLVDGVIAGVGGVIV
FLPQILILFLFILALEDSGYLPRAAFLLDRVMGTVGLSGRSFIPLLSSFACAIPGVMATR
TISNWRDRITTIMIAPLMTCSARLPVYALLIAAFIPARTVGGVFNLQGVVLFALYVFGIV
SAMAVAWVMKRFRDNTAHSPLMMELPAYRWPNPRNLALGLYERAWIFLQRVGTIILTLTI
LLWFLSTFPSPPEGATGPAIQYSLAGMIGRGLEHIFAPIGFNWQISIALVPGMAAREVAV
GALGTVYALSATGDDVAGQLEPLIAGSWSLATALSLLVWYVFAPQCISTLAAVKRETGSW
RYVWIMAGYLFALAYMACFITYRVAVALGAG