Protein Info for GFF3916 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Acetate permease ActP (cation/acetate symporter)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 48 (21 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 208 to 230 (23 residues), see Phobius details amino acids 275 to 298 (24 residues), see Phobius details amino acids 316 to 337 (22 residues), see Phobius details amino acids 368 to 396 (29 residues), see Phobius details amino acids 417 to 436 (20 residues), see Phobius details amino acids 442 to 466 (25 residues), see Phobius details amino acids 474 to 497 (24 residues), see Phobius details amino acids 512 to 533 (22 residues), see Phobius details PF00474: SSF" amino acids 61 to 482 (422 residues), 386.4 bits, see alignment E=7.9e-120 TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 61 to 482 (422 residues), 199.3 bits, see alignment E=5.7e-63

Best Hits

KEGG orthology group: K14393, cation/acetate symporter (inferred from 86% identity to azo:azo0978)

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (565 amino acids)

>GFF3916 Acetate permease ActP (cation/acetate symporter) (Hydrogenophaga sp. GW460-11-11-14-LB1)
VLTLLALASVSVAAWAAGADLGQADKQATNWTAIGMFGLFVLGTLYITKWAAAKTRSASD
FYTAGGGITGFQNGLAIAGDYMSAASFLGISAAVMASGFDGLIYSIGFLVGWPVITFLMA
ERLRNLGKFTFADVAAFRFQQAPIRIFAASGTLVVVAFYLIAQMVGAGQLIKLLFGLEYW
IAVVIVGALMMVYVLFGGMTATTWVQIIKACLLLGGASFMAFMVLLHFGFSPEAMFAGAV
KIKTELALKDGKVAEAAASIGQSIMGPGNFVKDPISAISFGMALMFGTAGLPHILMRFFT
VPSAKEARKSVMWATGWIGYFYLLTFIIGFGAITFVLTNPQFLDAKGGLLGGNNMAAVHL
ASAVGGNVFLGFISAVAFATILAVVAGLTLSGASAVSHDLYATVLKKGKADSAAELRVSK
ITTIGLGIVAVVLGIAFEKQNIAFMVSLAFAIAASANFPVLFMSVLWKDCTTKGAVIGGF
LGLVSSVALTVVSPSVWEATLGNPKGSALFPYTSPALFSMAIGFAGIWLFSVLDKSQRAR
VDRAGFLAQQVRSETGIGAAAASAH