Protein Info for GFF3911 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Histidinol-phosphate aminotransferase (EC 2.6.1.9)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 TIGR01141: histidinol-phosphate transaminase" amino acids 14 to 355 (342 residues), 409.3 bits, see alignment E=5.6e-127 PF00155: Aminotran_1_2" amino acids 49 to 354 (306 residues), 245.3 bits, see alignment E=5.9e-77

Best Hits

Swiss-Prot: 100% identical to HIS8_SALTY: Histidinol-phosphate aminotransferase (hisC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00817, histidinol-phosphate aminotransferase [EC: 2.6.1.9] (inferred from 99% identity to sec:SC2083)

MetaCyc: 89% identical to histidinol-phosphate aminotransferase (Escherichia coli K-12 substr. MG1655)
Histidinol-phosphate transaminase. [EC: 2.6.1.9]

Predicted SEED Role

"Histidinol-phosphate aminotransferase (EC 2.6.1.9)" in subsystem Histidine Biosynthesis (EC 2.6.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>GFF3911 Histidinol-phosphate aminotransferase (EC 2.6.1.9) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSTENTLSVADLARENVRNLVPYQSARRLGGNGDVWLNANEFPTAVEFQLTQQTLNRYPE
CQPKAVIENYAQYAGVKPEQVLVSRGADEGIELVIRAFCEPGKDAILYCPPTYGMYSVSA
ETIGVERRTVPALENWQLDLQGISDNLDGTKVVFVCSPNNPTGQLINPQDLRTLLELTRG
KAIVVADEAYIEFCPQATLTGWLVEYPHLVILRTLSKAFALAGLRCGFTLANEEVINLLL
KVIAPYPLSTPVADIAAQALCPQGINAMRDRVAQTVQERQYLVNALQQTACVEHVFDSET
NYILARFTASSSVFKSLWDQGIILRDQNKQPSLSGCLRITVGTRQENQRVIDALRAEPV