Protein Info for GFF3909 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Imidazole glycerol phosphate synthase amidotransferase subunit (EC 2.4.2.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01855: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit
  • amino acids 3 to 196 (194 residues), 244.5 bits, E=4.3e-77
• PF00117: GATase
  • amino acids 12 to 194 (183 residues), 71.7 bits, E=6.8e-24

Best Hits

Swiss-Prot: 100% identical to HIS5_SALPA: Imidazole glycerol phosphate synthase subunit HisH (hisH) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K02501, glutamine amidotransferase [EC: 2.4.2.-] (inferred from 100% identity to sea:SeAg_B2200)

MetaCyc: 91% identical to imidazole glycerol phosphate synthase subunit HisH (Escherichia coli K-12 substr. MG1655)
GLUTAMIDOTRANS-RXN [EC: 4.3.2.10]

Predicted SEED Role

"Imidazole glycerol phosphate synthase amidotransferase subunit (EC 2.4.2.-)" in subsystem Histidine Biosynthesis (EC 2.4.2.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• L-histidine biosynthesis (10/10 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (1/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (1/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.-

Use Curated BLAST to search for 2.4.2.- or 4.3.2.10

Protein Sequence (196 amino acids)

>GFF3909 Imidazole glycerol phosphate synthase amidotransferase subunit (EC 2.4.2.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNVVILDTGCANLSSVKSAVARHGYTPVVSREAEIVLRADKLFLPGVGTAQAAMDQLRER
ELIDLIKACTQPVLGICLGMQLLGRRSEETRGVDLLNIIEQDVPKMTDFGLPLPHMGWNR
VYPQAGNRLFQGIEDGAYFYFVHSYAMPVNPWTIAQCNYGEPFTAAVQKDNFFGVQFHPE
RSGAAGAQLLKNFLEM