Protein Info for GFF3908 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: probable oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00258: Flavodoxin_1" amino acids 53 to 179 (127 residues), 96.4 bits, see alignment E=1.8e-31 PF00175: NAD_binding_1" amino acids 326 to 431 (106 residues), 44.8 bits, see alignment E=1.8e-15

Best Hits

KEGG orthology group: K00380, sulfite reductase (NADPH) flavoprotein alpha-component [EC: 1.8.1.2] (inferred from 58% identity to mpt:Mpe_A3726)

Predicted SEED Role

"probable oxidoreductase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.2

Use Curated BLAST to search for 1.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (459 amino acids)

>GFF3908 probable oxidoreductase (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTSEKMLYALATLLCYALLCVAMAWQHRNRQRAAQRRVDALLPATPGVPAWWVAYASQTG
QAEELALQTAQALHTAGVPVRLAPLSQISLADLQQADRLLCIASTYGEGDPPDSAVPFAR
QVMADAGVTLSHLHVGLLALGDKTYAHFCGFGRQLDQWLTDRGAQALFERIDVDKSDPDA
LQRWRQHLAHLAGTSDLPDWEAPALQPWRLRTREHLNPGSAGEEVHHLELVPEAAGAALP
EWQAGDLVQVEVPAAPGEPRDYSIASVPQDGAVHLLVRRTRRADGSPGQASGWLTQAAQT
GETVMLRVRPHGGFRIGDNAQRPLILIGNGTGLAGLRGHMRARVAAGKGQAPMWLLFGER
NATCDAHYRDEIDAWQRDGWLRRVDWVFSRDQVERLYVQHALAEAADTVRQWVADGAAIY
VCGSLEGMAGEVNATLQTILGEEALQQLAADGRYRRDVY