Protein Info for GFF3902 in Variovorax sp. SCN45

Annotation: Trans-aconitate 2-methyltransferase (EC 2.1.1.144)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 PF13489: Methyltransf_23" amino acids 14 to 146 (133 residues), 67.4 bits, see alignment E=3.7e-22 PF05175: MTS" amino acids 23 to 82 (60 residues), 26.3 bits, see alignment E=1.6e-09 PF13847: Methyltransf_31" amino acids 31 to 142 (112 residues), 58.5 bits, see alignment E=2e-19 PF13649: Methyltransf_25" amino acids 35 to 127 (93 residues), 65.5 bits, see alignment E=1.8e-21 PF08241: Methyltransf_11" amino acids 36 to 130 (95 residues), 58 bits, see alignment E=3.8e-19 PF08242: Methyltransf_12" amino acids 36 to 129 (94 residues), 58.9 bits, see alignment E=2.2e-19

Best Hits

Swiss-Prot: 88% identical to TAM_VARPS: Trans-aconitate 2-methyltransferase (tam) from Variovorax paradoxus (strain S110)

KEGG orthology group: K00598, trans-aconitate 2-methyltransferase [EC: 2.1.1.144] (inferred from 90% identity to vpe:Varpa_1577)

Predicted SEED Role

"Trans-aconitate 2-methyltransferase (EC 2.1.1.144)" (EC 2.1.1.144)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.144

Use Curated BLAST to search for 2.1.1.144

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>GFF3902 Trans-aconitate 2-methyltransferase (EC 2.1.1.144) (Variovorax sp. SCN45)
MLDWNPALYRRYEDERTRPAQELLARVPLTEAARVVDLGCGPGNSTELLVRRFPKAQVTG
TDNSEAMLASARERLPQARFELSDIATWAPRSPEEAPDLIYANASLQWVPDHEKLIPRLF
DALAPGGVLAVQMPDNRQESTHRLMRAVAAEAPWAEPIGDADRLRTRLLDLAGYYDLLAP
RAAHVDVWHTIYQHRMADAASIVEWVRGTGLKPFVDRLEPALQASYLAEYERRVNEAYPA
RTDGKRLLAFPRMFIVAQKGGNA