Protein Info for PS417_01985 in Pseudomonas simiae WCS417

Annotation: 3-dehydroquinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01357: 3-dehydroquinate synthase
  • amino acids 13 to 349 (337 residues), 389.8 bits, E=5.8e-121
• PF13685: Fe-ADH_2
  • amino acids 17 to 170 (154 residues), 38.5 bits, E=1.7e-13
• PF01761: DHQ_synthase
  • amino acids 65 to 177 (113 residues), 170.8 bits, E=1.1e-54
• PF24621: DHQS_C
  • amino acids 179 to 323 (145 residues), 171.3 bits, E=1.9e-54

Best Hits

Swiss-Prot: 99% identical to AROB_PSEFS: 3-dehydroquinate synthase (aroB) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K01735, 3-dehydroquinate synthase [EC: 4.2.3.4] (inferred from 99% identity to pfs:PFLU0412)

MetaCyc: 58% identical to 3-dehydroquinate synthase (Escherichia coli K-12 substr. MG1655)
3-dehydroquinate synthase. [EC: 4.2.3.4]

Predicted SEED Role

"3-dehydroquinate synthase (EC 4.2.3.4)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Type IV pilus (EC 4.2.3.4)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• superpathway of chorismate metabolism (44/59 steps found)
• 3-dehydroquinate biosynthesis I (2/2 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.4

Sequence Analysis Tools

See A0A1N7UBP0 at UniProt or InterPro

Protein Sequence (366 amino acids)

>PS417_01985 3-dehydroquinate synthase (Pseudomonas simiae WCS417)
MQTLKVDLGERSYPIHIGEGLLDQPELLAPHIAGRQVAIISNETVAPLYLERLSRSLAAY
SVISVILPDGEAHKNWETLQLIFDGLLTARHDRRTTVIALGGGVIGDMAGFAAACYQRGV
DFIQVPTTLLSQVDSSVGGKTGINHPLGKNMVGAFYQPQAVLIDTTTLNTLPPRELSAGL
AEVIKYGLICDEPFLTWLEEHVDALRNLDQAALTEAISRSCAAKALVVNADERESGVRAT
LNLGHTFGHAIETHMGYGVWLHGEAVAAGTVMALEMSQRLGWISAQERDRGIRLFQRAGL
PVIPPEEMTEADFLEHMAIDKKVIDGRLRLVLLRHMGEAVVTDDYPKEILQATLGADYRA
LAQLKG