Protein Info for GFF3899 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Sensory histidine kinase BaeS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 209 to 231 (23 residues), see Phobius details PF00672: HAMP" amino acids 227 to 279 (53 residues), 58.3 bits, see alignment 1.6e-19 PF00512: HisKA" amino acids 283 to 345 (63 residues), 51.1 bits, see alignment E=2.2e-17 PF02518: HATPase_c" amino acids 392 to 502 (111 residues), 68.6 bits, see alignment E=1.3e-22

Best Hits

Predicted SEED Role

"Sensory histidine kinase BaeS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (508 amino acids)

>GFF3899 Sensory histidine kinase BaeS (Hydrogenophaga sp. GW460-11-11-14-LB1)
MQTDRANPSSSHRAWLSRFDTLRVKLFLAIAGANVVLVMSAYLIYSWSFDKGLVEYLNKA
DENRLQPMIVRLAEGYRQHGSWAWITEDRQRWQDLSREVLGTGRMPRRPAEPQTAPGLPP
PPPPPPLAAQPATAVANVPNVPPPFTIDPRLLLLDPQRNLLAGPEGRTEQAVLKPIQVND
QLVGYLGYVPRLQMVASLERVFLAQQTRTFAAIALGMLAAVLLNAALIARWLSRRLHVLG
EGTAAVAQGDYSVRLPARGHDELAQLADAFNHMATSLQAAQQARQQWIADIAHELRTPLA
TLRAEIEALQDGIRQPDTANLDSLAQEVGRLTRLVEDLRLLSLSDLGALDYRFAPLDLGR
FVGHHLSDAAGLPGRRLQVRTELADGVEIRADGDRLDQVLNNLMQNTQRYSADPATLNVQ
VRRHDTEAQLTWEDTSPGVPTEALPHLTERLYRVDASRASASGGSGLGLAIAHAIVVGHG
GRMQASASALGGLRWDIWLPLNTEAAHG