Protein Info for GFF3898 in Variovorax sp. SCN45

Annotation: Succinate dehydrogenase hydrophobic membrane anchor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 54 to 79 (26 residues), see Phobius details amino acids 94 to 119 (26 residues), see Phobius details PF01127: Sdh_cyt" amino acids 11 to 109 (99 residues), 47.3 bits, see alignment E=1.1e-16 TIGR02968: succinate dehydrogenase, hydrophobic membrane anchor protein" amino acids 14 to 119 (106 residues), 109.1 bits, see alignment E=6.1e-36

Best Hits

Swiss-Prot: 34% identical to DHSD_ECOL6: Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00242, succinate dehydrogenase hydrophobic membrane anchor protein (inferred from 95% identity to vap:Vapar_1429)

MetaCyc: 34% identical to succinate:quinone oxidoreductase, membrane protein SdhD (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Succinate dehydrogenase hydrophobic membrane anchor protein" in subsystem Succinate dehydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (121 amino acids)

>GFF3898 Succinate dehydrogenase hydrophobic membrane anchor protein (Variovorax sp. SCN45)
MSVNYGSKRIVVGAHYGLRDWLSQRITGGLMALFTIVLLAQLIFTRGPIGYDLWAGIFAA
QWMKVLTFSVIVALLYHVWVGMRDVWMDYVQPVAIRLVLQIFTIVWLVGCAGWAIQVLWK
I