Protein Info for GFF3898 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: O-antigen flippase Wzx

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 transmembrane" amino acids 71 to 88 (18 residues), see Phobius details PF13439: Glyco_transf_4" amino acids 73 to 173 (101 residues), 51.5 bits, see alignment E=1.9e-17 PF00534: Glycos_transf_1" amino acids 177 to 332 (156 residues), 99.1 bits, see alignment E=3.3e-32 PF13692: Glyco_trans_1_4" amino acids 185 to 318 (134 residues), 67.2 bits, see alignment E=2.9e-22

Best Hits

Swiss-Prot: 100% identical to RFBU_SALTY: Protein RfbU (rfbU) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 99% identity to sea:SeAg_B2211)

MetaCyc: 100% identical to GDP-mannose:alpha-L-Rha-(1->3)-alpha-D-Gal-PP-Und alpha-mannosyltransferase (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN-21843 [EC: 2.4.1.378]

Predicted SEED Role

"O-antigen flippase Wzx" in subsystem KDO2-Lipid A biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.378

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>GFF3898 O-antigen flippase Wzx (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MIVNLSRLGKSGTGMWQYSIKFLTALREIADVDAIICSKVHADYFEKLGYAVVTVPNIVS
NTSKTSRLRPLVWYVYSYWLALRVLIKFGNKKLVCTTHHTIPLLRNQTITVHDIRPFYYP
DSFIQKVYFRFLLKMSVKRCKHVLTVSYTVKDSIAKTYNVDSEKISVIYNSVNKSDFIQK
KEKENYFLAVGASWPHKNIHSFIKNKKVWSDSYNLIIVCGRTDYAMSLQQMVVDLELKDK
VTFLHEVSFNELKILYSKAYALVYPSIDEGFGIPPIEAMASNTPVIVSDIPVFHEVLTNG
ALYVNPDDEKSWQSAIKNIEQLPDAISRFNNYVARYDFDNMKQMVGNWLAESK