Protein Info for GFF3897 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: ABC transporter in pyoverdin gene cluster, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF01297: ZnuA" amino acids 148 to 289 (142 residues), 55 bits, see alignment E=4.6e-19

Best Hits

KEGG orthology group: None (inferred from 52% identity to pae:PA2410)

Predicted SEED Role

"ABC transporter in pyoverdin gene cluster, periplasmic component" in subsystem Siderophore Pyoverdine

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>GFF3897 ABC transporter in pyoverdin gene cluster, periplasmic component (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTSRLLSPPAWCLAGLLALSAGAATAQAPAAPTAAAAAAPARLLVAHPVVAALTTTLARD
TGIVVLRPVPETLPPNRQLAFFSGRGAAGLGEAARQADAVIALRSIWPDDPLFPLARRQN
IRLIEIDAARPLDASLPGMALQEQDTTANALPWLDPVNLGRMADVIASDVGRLVPAARPR
LQANVGALRQQLLTITAQSEARLATASNLAVFSLSDRLDYLVNGFNLDLAGTDARADEAW
TPEALTQLTQRLRSASVAAVLHHRDLPAPLAQAVQQAGAKTIVLQTEGRDPVAELRENAQ
RLGAIAAR