Protein Info for PS417_19945 in Pseudomonas simiae WCS417

Annotation: MarR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 PF12802: MarR_2" amino acids 31 to 91 (61 residues), 51.1 bits, see alignment E=2.5e-17 PF01047: MarR" amino acids 33 to 91 (59 residues), 42 bits, see alignment E=1.4e-14 PF13463: HTH_27" amino acids 34 to 96 (63 residues), 22.3 bits, see alignment E=2.6e-08 PF09339: HTH_IclR" amino acids 40 to 83 (44 residues), 23.1 bits, see alignment E=1e-08

Best Hits

Swiss-Prot: 37% identical to SLYA_SERS3: Transcriptional regulator SlyA (slyA) from Serratia sp. (strain ATCC 39006)

KEGG orthology group: K06075, MarR family transcriptional regulator, transcriptional regulator for hemolysin (inferred from 97% identity to pfs:PFLU4467)

Predicted SEED Role

"Transcriptional regulator SlyA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZU1 at UniProt or InterPro

Protein Sequence (144 amino acids)

>PS417_19945 MarR family transcriptional regulator (Pseudomonas simiae WCS417)
MPLTDQHRFGMQLAQMSRGWRAELDRRLAGLGLSQARWLVLLHLARFEEAPTQRELAQSV
GVEGPTLARLLDSLEGQGLVQRQAVVEDRRAKRILLCDTARPLIEQIETIATALRHELFV
GVDEADLSVCMRVHAHILSNLEKS