Protein Info for GFF3896 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: ABC transporter in pyoverdin gene cluster, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 24 to 48 (25 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 196 to 213 (18 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 268 to 291 (24 residues), see Phobius details PF00950: ABC-3" amino acids 26 to 286 (261 residues), 170.6 bits, see alignment E=4.7e-54 PF01032: FecCD" amino acids 63 to 250 (188 residues), 29.5 bits, see alignment E=3.9e-11

Best Hits

KEGG orthology group: K09816, zinc transport system permease protein (inferred from 79% identity to pst:PSPTO_2139)

Predicted SEED Role

"ABC transporter in pyoverdin gene cluster, permease component" in subsystem Siderophore Pyoverdine

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>GFF3896 ABC transporter in pyoverdin gene cluster, permease component (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSAFDTFRQGIQHLAEQGTLPASLAYGFVVNAVLAGLFIGPVLGGLGTLVVVKRLAFFSE
AVGHAALTGVAIGILLGEPYTGPYGSLFAYCLLFGMLLNYLRNRTGLSPDTLIGVFLAVS
LAMGASLLLMLSGRVNIHILENVLFGSVLTVDAGDLLVLAVVGSLVVALTVPLYNRFMLA
SFNPQLASVRGVRVKLLDYLFVVLVTIVTVASVKVIGAILVGALLIIPAAAARLLSLSLR
GFFWLSVGIATVSTQIGILLPIELELPVPSGAAIILTAGGLFALAAVIRGFTPSLKGHAG