Protein Info for GFF3887 in Sphingobium sp. HT1-2

Annotation: Protein of unknown function UPF0060

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 31 to 52 (22 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details PF02694: UPF0060" amino acids 2 to 107 (106 residues), 112.6 bits, see alignment E=5.4e-37

Best Hits

Swiss-Prot: 71% identical to Y1658_METSB: UPF0060 membrane protein Msil_1658 (Msil_1658) from Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)

KEGG orthology group: K09771, hypothetical protein (inferred from 71% identity to msl:Msil_1658)

Predicted SEED Role

"Protein of unknown function UPF0060"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (108 amino acids)

>GFF3887 Protein of unknown function UPF0060 (Sphingobium sp. HT1-2)
MQSILVYIAAALAEIAGCFAFWAWLRMDKSMLWLIPGTGSLLLFAWLLTLVDAAAAGRAY
AAYGGVYISSALLWLWLVEGVRPDRWDMAGVALSLVGAGIILFGPHRA