Protein Info for PS417_19895 in Pseudomonas simiae WCS417

Annotation: ATPase AAA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 PF01842: ACT" amino acids 2 to 61 (60 residues), 27.8 bits, see alignment E=6.2e-10 PF13188: PAS_8" amino acids 84 to 135 (52 residues), 22.3 bits, see alignment 3.3e-08 PF00158: Sigma54_activat" amino acids 209 to 375 (167 residues), 201.6 bits, see alignment E=2.7e-63 PF14532: Sigma54_activ_2" amino acids 211 to 380 (170 residues), 49.7 bits, see alignment E=1.8e-16 PF25601: AAA_lid_14" amino acids 387 to 450 (64 residues), 65 bits, see alignment E=1.6e-21 PF18024: HTH_50" amino acids 467 to 515 (49 residues), 57 bits, see alignment 4.5e-19 TIGR04381: TyrR family helix-turn-helix domain" amino acids 470 to 517 (48 residues), 79.2 bits, see alignment 8.6e-27

Best Hits

KEGG orthology group: K03721, transcriptional regulator of aroF, aroG, tyrA and aromatic amino acid transport (inferred from 98% identity to pfs:PFLU4457)

Predicted SEED Role

"Phenylalanine hydroxylase transcriptional activator PhhR" in subsystem Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZT3 at UniProt or InterPro

Protein Sequence (520 amino acids)

>PS417_19895 ATPase AAA (Pseudomonas simiae WCS417)
MRIKVHCQNRIGILRDILNLLVEYGVNVAKGEVGGEHGNAIYLFCPNLVNMQFQALRPQF
EAIAGVFGVKRVGLMPSERRHMELNALLGALEFPVLSIDMGGSIVAANRAAAQLLGVRVD
EVPGIPLSRYAEDFDLPELVRASKSRINGLRVKVKGDVFLADIAPLQSSEHDDSEAMAGA
VLTLHRADRVGERIYNVRKQELRGFDSIFQSSKVMAAVVREARRMAPLDAPLLIEGETGT
GKELLARACHLASPRGQSPLMALNCAGLPESMAETELFGYGPGAFEGARAEGKLGLLELT
AGGTLFLDGVGEMSARLQVKLLRFLQDGCFRRVGSDEEVYLDVRVICATQVDLSELCARG
EFRQDLYHRLNVLSLHIPPLRECLDGLAPLVDHFLDQASRQIGCPLPKLAPAAMDRLSHY
HWPGNVRQLENVLFQAVSLCEGGTVKVEHIRLPDYGVRQPLGDFSLEGGLEDIVGRFEKA
VLEALYAEHSSSRQLGKRLGVSHTTIANKLRDYEILKADK