Protein Info for GFF3885 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Integral membrane protein, interacts with FtsH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 transmembrane" amino acids 36 to 54 (19 residues), see Phobius details amino acids 60 to 82 (23 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details amino acids 208 to 233 (26 residues), see Phobius details PF01027: Bax1-I" amino acids 29 to 230 (202 residues), 142.1 bits, see alignment E=1.1e-45

Best Hits

Swiss-Prot: 34% identical to Y1358_VIBCH: Uncharacterized membrane protein VC_1358 (VC_1358) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K06890, (no description) (inferred from 74% identity to vap:Vapar_1802)

Predicted SEED Role

"Integral membrane protein, interacts with FtsH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>GFF3885 Integral membrane protein, interacts with FtsH (Hydrogenophaga sp. GW460-11-11-14-LB1)
MMKEITTMTDHVQTSGRFGTAVSSDALRNKVMRNTYWLLALSMLPTVLGAWIGVQTGITA
ALTGGLGLIVFLGGAFAFMFAIEKTKNSAAGVPVLLAFTFFMGLMLSRLLAAVLGFSNGS
SLIMTAFGGTAGVFFIMANLSTVIKRDLSGLGKWLFVGALAIMIGAIINVFVGSPIGMAV
IATLAIVVFSLYLLYDLKRIVDGGETNYITATLGLYLSLFNIFQSLLMLLGMFGGDRE