Protein Info for GFF3880 in Variovorax sp. SCN45

Annotation: Cell division integral membrane protein, YggT and half-length relatives

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 97 to 124 (28 residues), see Phobius details amino acids 158 to 182 (25 residues), see Phobius details PF02325: CCB3_YggT" amino acids 7 to 85 (79 residues), 55.1 bits, see alignment E=3.8e-19 amino acids 99 to 178 (80 residues), 68.1 bits, see alignment E=3.3e-23

Best Hits

KEGG orthology group: K02221, YggT family protein (inferred from 96% identity to vpe:Varpa_1557)

Predicted SEED Role

"Integral membrane protein YggT, involved in response to extracytoplasmic stress (osmotic shock)" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (186 amino acids)

>GFF3880 Cell division integral membrane protein, YggT and half-length relatives (Variovorax sp. SCN45)
MLYQIPSFLLDVIVGLLGGACLLRLYMQYHRVPFGNPLGRFIFAITDWIVLPLRRIVPSV
KRWDLASLIAAWLLVLVKFLLLWLLIGNLGRLATLPLVSLVGLMQLAVSGLTALLVVYAV
LSWIPGASPMLLDLISRLAEPLVRPFRRFIPLIGGIDLSPLAAIVVLQVIAIVLSNLLVL
AYQLTF