Protein Info for GFF388 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Lipopolysaccharide 1,2-N-acetylglucosaminetransferase (EC 2.4.1.56)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00534: Glycos_transf_1" amino acids 180 to 355 (176 residues), 144.2 bits, see alignment E=5.9e-46 PF20706: GT4-conflict" amino acids 186 to 370 (185 residues), 44.9 bits, see alignment E=1.6e-15 PF13692: Glyco_trans_1_4" amino acids 194 to 344 (151 residues), 89.6 bits, see alignment E=4.9e-29 PF13524: Glyco_trans_1_2" amino acids 223 to 372 (150 residues), 25.2 bits, see alignment E=2.7e-09

Best Hits

Swiss-Prot: 100% identical to WAAK_SALTY: Lipopolysaccharide 1,2-N-acetylglucosaminetransferase (waaK) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03280, UDP-N-acetylglucosamine:(glucosyl)LPS alpha-1,2-N-acetylglucosaminyltransferase [EC: 2.4.1.56] (inferred from 100% identity to seh:SeHA_C4039)

MetaCyc: 100% identical to lipopolysaccharide N-acetylglucosaminyltransferase (Salmonella enterica enterica serovar Typhimurium str. LT2)
Lipopolysaccharide N-acetylglucosaminyltransferase. [EC: 2.4.1.56]

Predicted SEED Role

"Lipopolysaccharide 1,2-N-acetylglucosaminetransferase (EC 2.4.1.56)" in subsystem LOS core oligosaccharide biosynthesis (EC 2.4.1.56)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.56

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (381 amino acids)

>GFF388 Lipopolysaccharide 1,2-N-acetylglucosaminetransferase (EC 2.4.1.56) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MIKKIIFTVTPIFSIPPRGAAAVETWIYQVAKRLSIPNAIACIKNAGYPEYNKINDNCDI
HYIGFSKVYKRLFQKWTRLDPLPYSQRILNIRDKVTTQEDSVIVIHNSMKLYRQIRERNP
NAKLVMHMHNAFEPELPDNDAKIIVPSQFLKAFYEERLPAAAVSIVPNGFCAETYKRNPQ
DNLRQQLNIAEDATVLLYAGRISPDKGILLLLQAFKQLRTLRSNIKLVVVGDPYASRKGE
KAEYQKKVLDAAKEIGTDCIMAGGQSPDQMHNFYHIADLVIVPSQVEEAFCMVAVEAMAA
GKAVLASKKGGISEFVLDGITGYHLAEPMSSDSIINDINRALADKERHQIAEKAKSLVFS
KYSWENVAQRFEEQMKNWFDK