Protein Info for GFF3879 in Variovorax sp. SCN45

Annotation: Uncharacterized protein, similar to the N-terminal domain of Lon protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details PF02190: LON_substr_bdg" amino acids 10 to 209 (200 residues), 103.9 bits, see alignment E=5.7e-34

Best Hits

KEGG orthology group: K07157, (no description) (inferred from 93% identity to vpe:Varpa_1556)

Predicted SEED Role

"Uncharacterized protein, similar to the N-terminal domain of Lon protease" in subsystem Proteasome bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>GFF3879 Uncharacterized protein, similar to the N-terminal domain of Lon protease (Variovorax sp. SCN45)
MTTQPLLHSLPLFPLGTVLFPGGLLPLRIFEVRYLDMIGKCRKADAPFGVVSLTSGSEVR
KAGADTESFAGIGTLAMIREFESPQSGLLQIECIGTQRFRVRHTELQKHGLWVAEVEAVN
DDVALEIPDDLKHTSTALRRLLDTLEERRRAQGESVRLPISAPYRLDDCGWVANRWCELV
PMQLELRQRLMELDSPLMRLELVSDLLARTGIAE