Protein Info for GFF3879 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: 5-nucleotidase SurE (EC 3.1.3.5)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00087: 5'/3'-nucleotidase SurE
  • amino acids 1 to 237 (237 residues), 218.5 bits, E=4.7e-69
• PF01975: SurE
  • amino acids 3 to 187 (185 residues), 205.7 bits, E=2.9e-65

Best Hits

Swiss-Prot: 76% identical to SURE_POLNA: 5'-nucleotidase SurE (surE) from Polaromonas naphthalenivorans (strain CJ2)

KEGG orthology group: K03787, 5'-nucleotidase [EC: 3.1.3.5] (inferred from 76% identity to pna:Pnap_2579)

Predicted SEED Role

"5-nucleotidase SurE (EC 3.1.3.5)" in subsystem Folate Biosynthesis (EC 3.1.3.5)

MetaCyc Pathways

• adenosine nucleotides degradation II (5/5 steps found)
• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• guanosine nucleotides degradation II (4/4 steps found)
• purine nucleotides degradation II (aerobic) (9/11 steps found)
• superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
• guanosine nucleotides degradation I (3/4 steps found)
• guanosine nucleotides degradation III (3/4 steps found)
• inosine 5'-phosphate degradation (3/4 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• ureide biosynthesis (5/7 steps found)
• NAD salvage pathway III (to nicotinamide riboside) (2/3 steps found)
• superpathway of purines degradation in plants (12/18 steps found)
• NAD salvage (plants) (6/11 steps found)
• tunicamycin biosynthesis (1/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5

Protein Sequence (259 amino acids)

>GFF3879 5-nucleotidase SurE (EC 3.1.3.5) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKILISNDDGYQAPGIVALYEALKGLAEVEVVAPEHNNSAKSNALSLHSPLYVHQAHNGF
RYVNGTPADCVHIALTGLLGYRPDLVVSGINNGANMGDDTIYSGTVGAAMEGYLFGVPAI
AFSQTEKGWAHLEDAGRMAARLVAQLLPSLENGPPAEPWLLNVNIPNRPLAELRGFKVAR
LGRRHVAEQVISQTNPRGETMYWIGSAGKAKDDAEGTDFHASLQGYATITPLQVDLTDHD
RLAYWAPTAASLSTGGTGS