Protein Info for GFF3876 in Xanthobacter sp. DMC5

Annotation: DNA replication and repair protein RecF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF02463: SMC_N" amino acids 6 to 369 (364 residues), 53.7 bits, see alignment E=3e-18 TIGR00611: DNA replication and repair protein RecF" amino acids 6 to 373 (368 residues), 169.8 bits, see alignment E=4.7e-54 PF13476: AAA_23" amino acids 8 to 49 (42 residues), 31.8 bits, see alignment 3.4e-11 PF13304: AAA_21" amino acids 30 to 50 (21 residues), 29.2 bits, see alignment (E = 1.4e-10)

Best Hits

Swiss-Prot: 45% identical to RECF_CAUVC: DNA replication and repair protein RecF (recF) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03629, DNA replication and repair protein RecF (inferred from 87% identity to xau:Xaut_0003)

Predicted SEED Role

"DNA recombination and repair protein RecF" in subsystem DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>GFF3876 DNA replication and repair protein RecF (Xanthobacter sp. DMC5)
MLHAAILKLSLTGFRSYPAAQVAVEARAIVLTGPNGAGKTNILEALSFLSPGRGLRRAQL
ADVGHRPPGAHMPDADGAPWAVSAFIEGALGEVRLGTGYDPAQEGGQRRCRIDGEAVPSA
NAFLDHLKVLWLTPEMDGLFLGPPGDRRRYLDRLVLAVDASHGTRVNGLERALRSRNRLL
EENGSGRFLDAMEHEVAELAVAVAAARLETVARLSAEIAAHRDEASPFPFAELALDGAVE
RLIAQHPALEVEDRYRALLRGNRPRDRAAGRTLEGPHLTDLSVSHGEKRLPAARCSTGEQ
KSLLIGLTLSHARLVGSMQGLSPLLLLDDVVAYLDAERRAGLFEALARLGAQVWMTGADP
SAFAALEMAARFTVAPGTITRA