Protein Info for GFF3875 in Xanthobacter sp. DMC5

Annotation: L-methionine sulfoximine/L-methionine sulfone acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 PF13302: Acetyltransf_3" amino acids 3 to 137 (135 residues), 33.7 bits, see alignment E=1.7e-11 PF13420: Acetyltransf_4" amino acids 3 to 157 (155 residues), 57.8 bits, see alignment E=4.1e-19 PF00583: Acetyltransf_1" amino acids 32 to 137 (106 residues), 64.2 bits, see alignment E=4.1e-21 PF13673: Acetyltransf_10" amino acids 39 to 115 (77 residues), 24.5 bits, see alignment E=6.8e-09 PF13508: Acetyltransf_7" amino acids 52 to 137 (86 residues), 38.2 bits, see alignment E=4.6e-13

Best Hits

Swiss-Prot: 56% identical to PAT_ALCFA: Phosphinothricin N-acetyltransferase (pat) from Alcaligenes faecalis

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 78% identity to xau:Xaut_0012)

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.183

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (179 amino acids)

>GFF3875 L-methionine sulfoximine/L-methionine sulfone acetyltransferase (Xanthobacter sp. DMC5)
MPIRPATPSDIPAITAIYDEAVRNGTASFELEPPGPEEMARRQAALMEGGYPYLVLEEDG
KVLGYAYASAFRPRVAYRYTVENSIYVDEAARGRRVGRRLLEALITECEALGFRQMVAVI
GDSGNAGSIALHRACGFGSIGTLPATGLKFGRWIDTVLMQRALGEGASTIPADADLLKG