Protein Info for GFF3875 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: GDP-mannose 4,6-dehydratase (EC 4.2.1.47)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 TIGR01472: GDP-mannose 4,6-dehydratase" amino acids 3 to 353 (351 residues), 588.7 bits, see alignment E=1.8e-181 PF01370: Epimerase" amino acids 5 to 252 (248 residues), 269.7 bits, see alignment E=4.2e-84 PF04321: RmlD_sub_bind" amino acids 6 to 162 (157 residues), 30.1 bits, see alignment E=5.5e-11 PF02719: Polysacc_synt_2" amino acids 6 to 117 (112 residues), 20.6 bits, see alignment E=4.7e-08 PF16363: GDP_Man_Dehyd" amino acids 6 to 346 (341 residues), 521.2 bits, see alignment E=2.9e-160

Best Hits

Swiss-Prot: 96% identical to GM4D_SHIFL: GDP-mannose 4,6-dehydratase (gmd) from Shigella flexneri

KEGG orthology group: K01711, GDPmannose 4,6-dehydratase [EC: 4.2.1.47] (inferred from 100% identity to sty:STY2321)

MetaCyc: 96% identical to GDP-mannose 4,6-dehydratase (Escherichia coli K-12 substr. MG1655)
GDP-mannose 4,6-dehydratase. [EC: 4.2.1.47]

Predicted SEED Role

"GDP-mannose 4,6-dehydratase (EC 4.2.1.47)" in subsystem Capsular heptose biosynthesis or Colanic acid biosynthesis (EC 4.2.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>GFF3875 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSKVALITGVTGQDGSYLAEFLLEKGYEVHGIKRRASSFNTERVDHIYQDPHSCNPKFHL
HYGDLTDASNLTRILQEVQPDEVYNLGAMSHVAVSFESPEYTADVDAMGTLRLLEAIRFL
GLEKKTRFYQASTSELYGLVQEIPQKETTPFYPRSPYAVAKLYAYWITVNYRESYGIYAC
NGILFNHESPRRGETFVTRKITRAIANIAQGLESCLYLGNMDSLRDWGHAKDYVRMQWMM
LQQEQPEDFVIATGVQYSVRQFVELAAAQLGIKLRFEGEGINEKGIVVSVTGHDAPGVKP
GDVIVAVDPRYFRPAEVETLLGDPSKAHEKLGWKPEITLSEMVSEMVANDLEAAKKHSLL
KSHGYEVAIALES