Protein Info for GFF3874 in Xanthobacter sp. DMC5

Annotation: Acetylglutamate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 PF00696: AA_kinase" amino acids 33 to 277 (245 residues), 164.9 bits, see alignment E=1.3e-52 TIGR00761: acetylglutamate kinase" amino acids 34 to 276 (243 residues), 249.7 bits, see alignment E=1.3e-78

Best Hits

Swiss-Prot: 85% identical to ARGB_AZOC5: Acetylglutamate kinase (argB) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K00930, acetylglutamate/acetylaminoadipate kinase [EC: 2.7.2.- 2.7.2.8] (inferred from 90% identity to xau:Xaut_0013)

Predicted SEED Role

"Acetylglutamate kinase (EC 2.7.2.8)" in subsystem Arginine Biosynthesis extended (EC 2.7.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.2.8

Use Curated BLAST to search for 2.7.2.- or 2.7.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>GFF3874 Acetylglutamate kinase (Xanthobacter sp. DMC5)
MTEPHSQSVSEAQHEAEVLARALPHMQRYDDAIVVVKYGGHAMGSEDVARTFASDIVLME
QSGINPVVVHGGGPQIGAMLSKLGIKSEFAAGLRITDKATVEIVEMVLAGSINKQIVGFI
NEAGGKAIGLCGKDGNMVRARKANRVMVSAGGDDAQEVDLGFVGEPDTVDTTVLDQILGR
ELIPVLAPVAAAVDGGTYNVNADTFAGAIAGALGAKRFLLLTDVPGVLDKNKQLIPRLTI
AEAHALIADGTISGGMIPKVETCIYALEKGVEGVVILDGKVPHAVLLELLTDHGAGTLIT
R