Protein Info for GFF3871 in Variovorax sp. SCN45

Annotation: GTP-binding protein Era

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 TIGR00436: GTP-binding protein Era" amino acids 28 to 303 (276 residues), 270.4 bits, see alignment E=1.6e-84 TIGR00231: small GTP-binding protein domain" amino acids 28 to 187 (160 residues), 102 bits, see alignment E=2.9e-33 PF02421: FeoB_N" amino acids 29 to 183 (155 residues), 53.8 bits, see alignment E=6.8e-18 PF00009: GTP_EFTU" amino acids 29 to 191 (163 residues), 31.3 bits, see alignment E=6.1e-11 PF04548: AIG1" amino acids 29 to 130 (102 residues), 32.7 bits, see alignment E=2e-11 PF01926: MMR_HSR1" amino acids 29 to 142 (114 residues), 89.3 bits, see alignment E=7.9e-29 PF00071: Ras" amino acids 30 to 186 (157 residues), 25.1 bits, see alignment E=4.6e-09 PF07650: KH_2" amino acids 238 to 308 (71 residues), 63.3 bits, see alignment E=6.2e-21

Best Hits

Swiss-Prot: 59% identical to ERA_RALSO: GTPase Era (era) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03595, GTP-binding protein Era (inferred from 96% identity to vap:Vapar_1403)

Predicted SEED Role

"GTP-binding protein Era" in subsystem Bacterial Cell Division or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>GFF3871 GTP-binding protein Era (Variovorax sp. SCN45)
MNDAINPVAGPEDPAGDAPATGPQHCGLIAIVGKPNVGKSTLLNALVGQKISITSRKAQT
TRHRITGMRTLGATQFVFVDTPGFQTLHANALNKSLNKTVQGAVGDVDLILFVVEAGSFT
PADERVLKLLGKGIPTVLLANKLDNVHRRGDIAPWLQTMQEKHSFAEFVPMSAKNAKDVE
RLFDICKKYLPEQPWFYDEDELTDRSEKFLAGELVREKLFRLTGDELPYTSTVIIDKFEE
EPPQKKGQKRLLRIAATIVVERDGHKAMVIGDKGERIKRIGMETRVELEKLADAKVFLEL
WVKVRSGWADDEARVRSFGYE