Protein Info for PS417_19815 in Pseudomonas simiae WCS417

Annotation: Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 PF00072: Response_reg" amino acids 5 to 114 (110 residues), 98.2 bits, see alignment E=1.3e-31 PF00158: Sigma54_activat" amino acids 134 to 296 (163 residues), 236.2 bits, see alignment E=7e-74 PF14532: Sigma54_activ_2" amino acids 143 to 296 (154 residues), 64.2 bits, see alignment E=6.4e-21 PF07728: AAA_5" amino acids 154 to 272 (119 residues), 32.2 bits, see alignment E=3.9e-11 PF00004: AAA" amino acids 154 to 273 (120 residues), 23.1 bits, see alignment E=3.5e-08 PF25601: AAA_lid_14" amino acids 302 to 375 (74 residues), 71.8 bits, see alignment E=1.3e-23 PF02954: HTH_8" amino acids 404 to 443 (40 residues), 51.2 bits, see alignment 3.4e-17

Best Hits

KEGG orthology group: K10943, two component system, response regulator FlrC (inferred from 98% identity to pfs:PFLU4441)

Predicted SEED Role

"Flagellar regulatory protein FleQ" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UCY1 at UniProt or InterPro

Protein Sequence (458 amino acids)

>PS417_19815 Fis family transcriptional regulator (Pseudomonas simiae WCS417)
MAIKVLLVEDDRALREALADTLLLAGHDYRAVGSAEAALEAVEQESFSLVVSDVNMPGMD
GHQLLGLLRARQPQLPVLLMTAHGAVERAVDAMRQGAADYLVKPFEPKALIELVVRHALG
VIPPSDGEGPIAFEPASAQLLELAARVARSDSTVLISGESGTGKEVLARYIHQQSTRAKQ
PFIAINCAAIPDNMLEATLFGHEKGSFTGAIAAQAGKFEQADGGTILLDEISEMPLGLQA
KLLRVLQEREVERVGARKPIQLDIRVVATTNRDLAGEVAAGRFREDLFYRLSVFPLAWRP
LRERPADIIPLAERLLNNHVKKMKHAQAGLSAEAQACLIAYPWPGNVRELDNAIQRALIL
QQGGLIQPQDFCLAMGSGAAPLPTLAPTPVVVEAETAGALGDDLRRREFQMIIDTLRSER
GRRKEAAERLGISPRTLRYKLAQMRDAGMDVEAYLFAT