Protein Info for PS417_19810 in Pseudomonas simiae WCS417

Annotation: flagellar hook-basal body protein FliE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 TIGR00205: flagellar hook-basal body complex protein FliE" amino acids 16 to 108 (93 residues), 91.5 bits, see alignment E=2.2e-30 PF02049: FliE" amino acids 26 to 109 (84 residues), 108.4 bits, see alignment E=8.1e-36

Best Hits

Swiss-Prot: 99% identical to FLIE_PSEFS: Flagellar hook-basal body complex protein FliE (fliE) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K02408, flagellar hook-basal body complex protein FliE (inferred from 99% identity to pfs:PFLU4440)

Predicted SEED Role

"Flagellar hook-basal body complex protein FliE" in subsystem Flagellum or Flagellum in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UL60 at UniProt or InterPro

Protein Sequence (109 amino acids)

>PS417_19810 flagellar hook-basal body protein FliE (Pseudomonas simiae WCS417)
MSQGIEFNRLMLDMRAMQMDAMAQPKSVAPAPELGQSSFADMLGQAINKVSDTQQASSQL
ANAFEIGKSGVDLTDVMVASQKASVSFQALTQVRNKLVQAYQDIMQMPV