Protein Info for GFF3865 in Variovorax sp. SCN45

Annotation: Sigma factor RpoE negative regulatory protein RseB precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF03888: MucB_RseB" amino acids 3 to 180 (178 residues), 190.4 bits, see alignment E=2e-60 PF17188: MucB_RseB_C" amino acids 198 to 309 (112 residues), 75.1 bits, see alignment E=4.3e-25

Best Hits

KEGG orthology group: K03598, sigma-E factor negative regulatory protein RseB (inferred from 91% identity to vpe:Varpa_1538)

Predicted SEED Role

"Sigma factor RpoE negative regulatory protein RseB precursor" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>GFF3865 Sigma factor RpoE negative regulatory protein RseB precursor (Variovorax sp. SCN45)
MSVTEWLQRMHAGARQRNYVGTFVVSAPGGDLSSARIWHVRDGDHQIERIEALSGPPRST
FRRNRNVMTFLPEAKVVKVEKRENLDLFPNLPDKPDSSIGDFYDVRAIGKDRVAGFDADV
VQLVPHDGLRFGYRVWSERRSGLVVKLQTVDSESRVVEQSAFSELQLDAPVKAQALAQMM
ANTSGYRIEKLELERSSAQDEGWTLSTPVAGFKPRSFFRRPPSGDSNNNGGKQKQQDATT
VQWTFSDGLASVSLFIERYDAARAPRDGVLTIGATNAIRRRLPEPASDWWLTAVGEVPQQ
TLNAFAQSLARTR