Protein Info for GFF3855 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Multidrug transporter MdtA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 61 to 389 (329 residues), 254.9 bits, see alignment E=4.6e-80 PF16576: HlyD_D23" amino acids 84 to 308 (225 residues), 38.3 bits, see alignment E=1.4e-13 PF13533: Biotin_lipoyl_2" amino acids 86 to 134 (49 residues), 53.9 bits, see alignment 1.9e-18 PF13437: HlyD_3" amino acids 197 to 301 (105 residues), 25.7 bits, see alignment E=2.3e-09

Best Hits

Swiss-Prot: 100% identical to MDTA_SALTY: Multidrug resistance protein MdtA (mdtA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K07799, putative multidrug efflux transporter MdtA (inferred from 99% identity to seh:SeHA_C2356)

MetaCyc: 81% identical to multidrug efflux pump membrane fusion protein MdtA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-353; TRANS-RXN-92

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>GFF3855 Multidrug transporter MdtA (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKGSNTFRWAIAIGVVVAAAAFWFWHSRSESPTAAPGVAAQAPHTASAGRRGMRDGPLAP
VQAATATTQAVPRYLSGLGTVTAANTVTVRSRVDGQLIALHFQEGQQVNAGDLLAQIDPS
QFKVALAQAQGQLAKDNATLANARRDLARYQQLAKTNLVSRQELDAQQALVNETQGTIKA
DEANVASAQLQLDWSRITAPVSGRVGLKQVDVGNQISSSDTAGIVVITQTHPIDLIFTLP
ESDIATVVQAQKAGKALVVEAWDRTNSHKLSEGVLLSLDNQIDPTTGTIKIKARFTNQDD
TLFPNQFVNARMLVDTEQNAVVVPAAAVQMGNEGHFVWVLNDENNVSKKRVKIGIQDNRN
VVISAGLSAGDRVVTDGIDRLTEGAKVEVVEPQTTVADEKSPSRHEGQKGARA