Protein Info for GFF3853 in Xanthobacter sp. DMC5

Annotation: Protease HtpX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 30 to 48 (19 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details PF01435: Peptidase_M48" amino acids 71 to 277 (207 residues), 135.4 bits, see alignment E=1e-43

Best Hits

Swiss-Prot: 90% identical to HTPX_XANP2: Protease HtpX homolog (htpX) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K03799, heat shock protein HtpX [EC: 3.4.24.-] (inferred from 90% identity to xau:Xaut_0034)

Predicted SEED Role

"Probable protease htpX homolog (EC 3.4.24.-)" (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>GFF3853 Protease HtpX (Xanthobacter sp. DMC5)
MNHLKTAILLAGMTALFMAVGFALGGRGGMMIAFVVAAGMNLFSYWNADKMVLRMYGARE
VDERTAPEFVGMVRELARRADLPMPRVFIMDNPQPNAFATGRNPQNAAVAATTGLLQTLT
PEEVAGVMAHELAHIKHYDTLTMTITATIAGAISMLANFGLLFGGGNRDNNNPFGFIGTI
LMVFLAPLAAMLVQMAISRSREYEADRGGAEILGRPMALASALAKISGEAHQVPNYEAEA
NPATAHMFIINPLSGARMDNLFSTHPAVENRIAALRDLSQRMGGGGFTAPGPAPAQPRRG
PWG