Protein Info for PS417_19730 in Pseudomonas simiae WCS417

Annotation: flagellar biosynthesis protein FliR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 45 to 62 (18 residues), see Phobius details amino acids 81 to 104 (24 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 180 to 204 (25 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details TIGR01400: flagellar biosynthetic protein FliR" amino acids 16 to 257 (242 residues), 256.5 bits, see alignment E=1.3e-80 PF01311: Bac_export_1" amino acids 17 to 246 (230 residues), 224 bits, see alignment E=9.8e-71

Best Hits

Swiss-Prot: 37% identical to FLIR_PECCC: Flagellar biosynthetic protein FliR (fliR) from Pectobacterium carotovorum subsp. carotovorum

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 95% identity to pfs:PFLU4423)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U4D7 at UniProt or InterPro

Protein Sequence (261 amino acids)

>PS417_19730 flagellar biosynthesis protein FliR (Pseudomonas simiae WCS417)
MQSLLALTDTQISTWVASFILPMFRVTAMLMAMPVFGTTLVPRRVRLYFAVAITVVIVPG
LPPMPPVNAIDLSALLLIAEQILIGALMGFSLTLFFQAFVVAGQIISIQMGMGFASMVDP
TNGVSAAVIGQFLTMLVTLLFLAMNGHLVAFEVMTESFTTLPVGSGLVVNHFWEVVGRLG
WVFGASLLLVLPAITALLVVNIAFGVMTRAAPQLNIFSIGFPLTLVLGMGIFWVGLADIL
NQYQPLATDALQFLRDLARAR