Protein Info for GFF3850 in Xanthobacter sp. DMC5

Annotation: Adenylosuccinate synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00184: adenylosuccinate synthase
  • amino acids 5 to 429 (425 residues), 527.8 bits, E=1e-162
• PF00709: Adenylsucc_synt
  • amino acids 5 to 423 (419 residues), 590.7 bits, E=7.4e-182

Best Hits

Swiss-Prot: 89% identical to PURA_AZOC5: Adenylosuccinate synthetase (purA) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K01939, adenylosuccinate synthase [EC: 6.3.4.4] (inferred from 96% identity to xau:Xaut_0037)

Predicted SEED Role

"Adenylosuccinate synthetase (EC 6.3.4.4)" in subsystem CBSS-262719.3.peg.410 or Purine conversions (EC 6.3.4.4)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• superpathway of purine nucleotide salvage (11/14 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Biosynthesis of alkaloids derived from histidine and purine
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.4

Protein Sequence (431 amino acids)

>GFF3850 Adenylosuccinate synthetase (Xanthobacter sp. DMC5)
VANVVVVGSQWGDEGKGKIVDWLSEQADVVVRFQGGHNAGHTLVVGGVTYKLSLLPSGVV
RPGKLSVIGNGVVLDPQALVDELARLAAQGIEIGPDRLRIAETVPLILPLHRELDALRES
ATAEGARIGTTKRGIGPAYEDKVGRRAIRLVDLTDPATLPAKVDRLLTHHNLIRRGLGMA
EVDGAALVAELMALAPRVLPFMDRVWELLDKARRDGKKILFEGAQGALLDIDHGTYPYVT
SSNTVAGSAASGTGIGPGALDYVLGITKAYTTRVGEGPFPTELLDEVGKTLGTKGHEFGV
VTGRARRCGWFDAVLVRQTVRTCGIHGIALTKLDVLDGFNELKVCVGYKVDGKEIDYLPA
ESGAQARAEPIYETMEGWQDSTAGARSWADLPAEAVKYVRRVEELIGCPVSVLSTSPERD
DTILVHNPFQA