Protein Info for GFF3850 in Xanthobacter sp. DMC5

Annotation: Adenylosuccinate synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 PF00709: Adenylsucc_synt" amino acids 5 to 423 (419 residues), 593.1 bits, see alignment E=1.4e-182 TIGR00184: adenylosuccinate synthase" amino acids 5 to 429 (425 residues), 527.8 bits, see alignment E=1e-162

Best Hits

Swiss-Prot: 89% identical to PURA_AZOC5: Adenylosuccinate synthetase (purA) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K01939, adenylosuccinate synthase [EC: 6.3.4.4] (inferred from 96% identity to xau:Xaut_0037)

Predicted SEED Role

"Adenylosuccinate synthetase (EC 6.3.4.4)" in subsystem CBSS-262719.3.peg.410 or Purine conversions (EC 6.3.4.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>GFF3850 Adenylosuccinate synthetase (Xanthobacter sp. DMC5)
VANVVVVGSQWGDEGKGKIVDWLSEQADVVVRFQGGHNAGHTLVVGGVTYKLSLLPSGVV
RPGKLSVIGNGVVLDPQALVDELARLAAQGIEIGPDRLRIAETVPLILPLHRELDALRES
ATAEGARIGTTKRGIGPAYEDKVGRRAIRLVDLTDPATLPAKVDRLLTHHNLIRRGLGMA
EVDGAALVAELMALAPRVLPFMDRVWELLDKARRDGKKILFEGAQGALLDIDHGTYPYVT
SSNTVAGSAASGTGIGPGALDYVLGITKAYTTRVGEGPFPTELLDEVGKTLGTKGHEFGV
VTGRARRCGWFDAVLVRQTVRTCGIHGIALTKLDVLDGFNELKVCVGYKVDGKEIDYLPA
ESGAQARAEPIYETMEGWQDSTAGARSWADLPAEAVKYVRRVEELIGCPVSVLSTSPERD
DTILVHNPFQA