Protein Info for GFF3848 in Variovorax sp. SCN45

Annotation: Similar to phosphoglycolate phosphatase, clustered with ribosomal large subunit pseudouridine synthase C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 PF00702: Hydrolase" amino acids 11 to 184 (174 residues), 109.7 bits, see alignment E=6.1e-35 PF13419: HAD_2" amino acids 13 to 190 (178 residues), 127.7 bits, see alignment E=1.4e-40 PF12710: HAD" amino acids 13 to 180 (168 residues), 46.7 bits, see alignment E=1.3e-15 TIGR01662: HAD hydrolase, family IIIA" amino acids 83 to 190 (108 residues), 50.4 bits, see alignment E=3.8e-17 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 90 to 190 (101 residues), 42.9 bits, see alignment E=8.5e-15 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 105 to 184 (80 residues), 40.1 bits, see alignment E=7.1e-14 PF13242: Hydrolase_like" amino acids 145 to 215 (71 residues), 62.9 bits, see alignment E=5.2e-21

Best Hits

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 94% identity to vap:Vapar_1380)

Predicted SEED Role

"Similar to phosphoglycolate phosphatase, clustered with ribosomal large subunit pseudouridine synthase C" in subsystem 2-phosphoglycolate salvage

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>GFF3848 Similar to phosphoglycolate phosphatase, clustered with ribosomal large subunit pseudouridine synthase C (Variovorax sp. SCN45)
MTDASRPLRFDLIAFDWDGTLYDSTRLIVRCIQAAVIDVGGAKPSENDAAWVIGLGLAEA
LARAAPDVPKEKYPELGARYRYHYLQHQDDLVLFDGVLQMLDALRARGHKLAVATGKSRR
GLNEALKSVALRDRFDASRTADETFGKPHPRMLLELMEELDVTPERTLMIGDTTHDLQLA
QNAGCASVGVSYGAHEPASFDEFKPLHVAHSVADLEAWLMGNA