Protein Info for GFF3845 in Sphingobium sp. HT1-2

Annotation: Two-component transcriptional response regulator, LuxR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 PF00072: Response_reg" amino acids 16 to 129 (114 residues), 54.2 bits, see alignment E=5.5e-18 PF14532: Sigma54_activ_2" amino acids 162 to 332 (171 residues), 55.8 bits, see alignment E=2.2e-18 PF00158: Sigma54_activat" amino acids 162 to 327 (166 residues), 204.8 bits, see alignment E=2.6e-64 PF07728: AAA_5" amino acids 184 to 303 (120 residues), 38.3 bits, see alignment E=4.6e-13 PF25601: AAA_lid_14" amino acids 333 to 406 (74 residues), 72.7 bits, see alignment E=6.2e-24 PF02954: HTH_8" amino acids 432 to 472 (41 residues), 45.4 bits, see alignment 1.9e-15

Best Hits

KEGG orthology group: None (inferred from 47% identity to pgn:PGN_0012)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (474 amino acids)

>GFF3845 Two-component transcriptional response regulator, LuxR family (Sphingobium sp. HT1-2)
MTEGRMTQEKPFELCVVIDDDDDILLAARLLLRAIFGEVLTFRDPESAFAATAGLTPEAF
LLDANFSRGATNAAEGFEWLGRFLARDPQAVIVMITAHAGVQVAIEAMKRGATDFVTKPW
SNERLLATVRTAAALRASRKAVAQKDKVAMIAAAPAGETPLLGTSPAMARVQQLIDRAAP
TDANVLILGENGTGKELVARELHRRSRRAERIMLPVDLGAVAESVIDSELFGHVKGAFTD
ARADRIGRLQAADGGTLFLDEIGNLPLHLQPKLLTALEQRKVTPVGANKPVPVDIRVIAA
TNLSAGQIADEGRFRQDLLFRLNTVEIVLPPLRERREDIHALIAHYHALYARKYAQPVHP
IAPELMAALVAYDWPGNVRALRHAIERAVILAGDAPFGIEDIPLRSHGSPEPVRIDRAAV
VEAPPTPDDMNLERVERRLVETALMKHGYNISSAAAELGLTRASLYRRMEKHGL